PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1075251g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 143aa    MW: 16182.3 Da    PI: 10.3696
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1075251g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.86.8e-204995148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g WT+eEd +l +av+++ g++Wk+Ia++++  Rt+ qc +rwqk+l
  PDK_30s1075251g002 49 KGQWTPEEDAILCRAVQKFRGKNWKKIAECFP-DRTDVQCLHRWQKVL 95
                        799*****************************.************986 PP

2Myb_DNA-binding51.71.9e-16101142143
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                         +g+W++eEde++++ v  +G++ W+tIa+ ++ gR +kqc++r
  PDK_30s1075251g002 101 KGPWSKEEDEKIIQMVDTYGPKKWSTIAQALP-GRIGKQCRER 142
                         79******************************.********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8964495IPR017930Myb domain
SMARTSM007174.1E-164897IPR001005SANT/Myb domain
PfamPF002497.3E-184995IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2550102IPR009057Homeodomain-like
CDDcd001672.01E-145295No hitNo description
SuperFamilySSF466892.66E-2475142IPR009057Homeodomain-like
PROSITE profilePS5129425.93896143IPR017930Myb domain
SMARTSM007171.1E-7100143IPR001005SANT/Myb domain
PfamPF002496.4E-15101142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-22103142IPR009057Homeodomain-like
CDDcd001671.18E-12103142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MASDKGKSAK KGETSASSST AVQDGSSDEI QRQRPLHGRT TGPTRRSTKG QWTPEEDAIL  60
CRAVQKFRGK NWKKIAECFP DRTDVQCLHR WQKVLNPELV KGPWSKEEDE KIIQMVDTYG  120
PKKWSTIAQA LPGRIGKQCR ERT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-38491426142MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-38491426142MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008795072.12e-95PREDICTED: myb-related protein 3R-1-like isoform X2
SwissprotQ9S7G74e-61MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLQ5QT306e-76Q5QT30_ORYSA; Transcription factor (Fragment)
TrEMBLM0S9I02e-75M0S9I0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P19890_0016e-75(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.13e-62Homeodomain-like protein